PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0115s0270.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NF-YB
Protein Properties Length: 169aa    MW: 18065.2 Da    PI: 4.6378
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0115s0270.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB181.28.7e-5725120297
                   NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 
                             re drflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrkt+ngddllwa++tlGfe+yveplkvyl+
  SapurV1A.0115s0270.1.p  25 REMDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTVNGDDLLWAMTTLGFEEYVEPLKVYLQ 111
                             799************************************************************************************ PP

                   NF-YB  89 kyrelegek 97 
                             ++re+egek
  SapurV1A.0115s0270.1.p 112 RFREAEGEK 120
                             ******996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-5223126IPR009072Histone-fold
SuperFamilySSF471132.64E-3928128IPR009072Histone-fold
PfamPF008085.4E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.8E-215876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.8E-217795No hitNo description
PRINTSPR006157.8E-2196114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MADSDNESGG GGQNPANTNE LLSPREMDRF LPIANVSRIM KKALPANAKI SKDAKETVQE  60
CVSEFISFIT GEASDKCQRE KRKTVNGDDL LWAMTTLGFE EYVEPLKVYL QRFREAEGEK  120
ITVGRDKDAP SNGSGIGVEG FGGYVYGSGG FCFNQLGGGP GDSLGRLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B9e-4722115194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A9e-4722115194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2140281e-150AC214028.1 Populus trichocarpa clone POP025-N21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298867.12e-97hypothetical protein POPTR_0001s37620g
SwissprotO233108e-69NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLB9GFM02e-97B9GFM0_POPTR; Uncharacterized protein
STRINGPOPTR_0001s37620.16e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-70nuclear factor Y, subunit B3